|
Advertisement | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecular & Cellular Proteomics 5:2072-2082, 2006.
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ABSTRACT |
|---|
|
|
|---|
In classical studies, it was shown that TR4 could bind to direct repeat (DR) AGGTCA with variable spacer nucleotides in the promoters of putative target genes (1013). These target genes could be activated or repressed. Among the potential target sequences, the DR1 sequence of the apolipoprotein E/C-I/C-II gene cluster was confirmed in the TR4 gene knock-out studies (13). In addition, TR4 was also shown to be an important regulator of other nuclear receptor signaling pathways, such as in pathways involving retinoic acid receptor, retinoid X receptor, peroxisome proliferator-activated receptor (PPAR), vitamin D3 receptor, thyroid hormone receptor, estrogen receptor, and another closely related orphan member, TR2 (14). Together these studies suggested TR4 as an important member of nuclear receptors. Despite the widely demonstrated transcriptional regulatory activity of TR4, it remains unclear how the activity of TR4, as an activator or a repressor, is triggered without the involvement of specific ligands.
Our recent proteomics studies of another orphan receptor, TR2, revealed interesting regulatory mechanisms mediated by receptor phosphorylation that could modulate its biological activities (15, 16). We thus set out to determine whether TR4 could also be regulated by protein modification such as phosphorylation. A systematic mass spectrometry-based proteomics analysis of TR4 was initiated by examining modifications of TR4 protein expressed in insect cells, a widely used eukaryotic system for protein expression. In this endeavor, we identified three mitogen-activated protein kinase-mediated phosphorylation sites on the activation function 1 (AF-1) domain of TR4. To validate the biological effects of these modified residues, site-specific mutants were generated, and their biological activities were examined. We also determined the coregulatory mechanisms underlying the activating versus repressive activities of TR4 as well as its mutants by identifying the specific coactivator and corepressor involved. We now report that Ser19, Ser55, and Ser68 at the AF-1 domain of TR4 can be phosphorylated by MAPK, but only phosphorylation on Ser19 and Ser68 has a biological consequence in terms of the regulation of its target gene expression. We also demonstrate that hyperphosphorylation of its AF-1 domain renders TR4 a repressor, whereas hypophosphorylation of this domain makes TR4 an activator. Its biological activities are mediated through the specific recruitment of coactivator PCAF and corepressor RIP140 by the hypophosphorylated and hyperphosphorylated forms of the protein, respectively.
| EXPERIMENTAL PROCEDURES |
|---|
|
|
|---|
LBD, and Gal4TR4-LBD plasmids were constructed as described previously (17). GST-TR4
LBD was subcloned from GFP-TR4
LBD into pGEX-2T expression vector. His-tagged TR4-LBD was subcloned from Gal4-TR4LBD into His-tagged expression vector (pET28, Novagen). Luciferase reporter containing DR1 response element derived from mouse hepatic control region-1 of apoE gene was constructed using synthetic oligonucleotides. The sense (5'-CTA GAA TGG CAG AGG TCA TCT AGA ATG GCA GAG GTC A-3') and the antisense (5'-GAT CTG ACC TCT GCC ATT CTA GAT GAC CTC TGC CAT TCT AGA TGA CCT CTG CCA T-3') oligonucleotides were annealed, phosphorylated by T4 kinase, and ligated to BamHI/NheI sites into pGL3-promoter vector (Promega). The underlined characters indicate the response element, and the bold character indicates the spacer nucleotide. For the expression of TR4 protein in the baculovirus system, the full-length TR4 cDNA tagged with an HA epitope was inserted into pVL1393 (Invitrogen) at the EcoRI and the XbaI sites.
Expression and Purification of TR4
Sf21 insect cells (1 x 106) were infected with recombinant baculovirus vector. After 72 h, the cells from 500-ml culture were harvested by centrifugation at 6000 rpm for 10 min at 4 °C, and the pellet was kept frozen at 80 °C. The cell pellet was then resuspended in 30 ml of 10 mM HEPES, pH 7.9, containing 10 mM NaCl and 1.5 mM MgCl2, diluted with an equal volume of HEPES buffer containing 0.1% Nonidet P-40, and incubated on ice for 30 min followed by centrifugation for 5 min at 2000 rpm at 4 °C. The nuclear pellet was resuspended in 60 ml of 20 mM HEPES (pH 7.9) buffer, 420 mM NaCl, 1.5 mM MgCl2, and 25% glycerol and incubated on ice for an additional 30 min prior to centrifugation at 2000 rpm at 4 °C. This nuclear pellet was then resuspended in 40 ml of 20 mM HEPES, pH 7.9, 2 M NaCl, 1.5 mM MgCl2, and 25% glycerol and sonicated on ice until the clear homogeneous solution was obtained. The homogenate was centrifuged at 15,000 rpm for 30 min at 4 °C. The pellet was solubilized in 20 ml of an extraction buffer containing 50 mM sodium phosphate buffer, pH 7.0, 6 M guanidine HCl, and 300 mM NaCl and sonicated to obtain a clear homogenate. The homogenate was then dialyzed against a buffer containing 50 mM phosphate buffer, pH 7.5, 250 mM NaCl, 1 mM DTT, 0.15 mM PMSF, and 1 M urea for 2 h at 4 °C. The protein was then subjected to affinity purification on anti-HA-agarose affinity resins following the manufacturers protocol. The purified protein was resolved by 8% SDS-PAGE.
Mass Spectrometric Analysis of TR4
Mass spectral analysis of TR4 protein sample was conducted according to the established procedure described previously (18, 19). Purified HA-tagged TR4 protein from insect cells was resolved by SDS-PAGE. Gel slices containing TR4 were subjected to overnight in-gel tryptic digestion. The samples were analyzed by MALDI-TOF MS (QSTAR XL, Applied Biosystems, Inc., Foster City, CA) using
-cyano-4-hydroxycinnamic acid as a matrix in a positive ion reflection mode. For LC-MS, an LC Packings (Dionex, Sunnyvale, CA) Famos autosampler and an LC Packings Switchos pump were used to concentrate and desalt the sample on an LC Packings C18 nanoprecolumn. The precolumn was connected in line with a capillary column (100-µm inner diameter, 5 µm, 200-Å-pore size C18 particles), and peptides were eluted in a gradient system of ACN and H2O containing 0.1% TFA using an LC Packings Ultimate LC system over 65 min.
The LC system was on line with Applied Biosystems, Inc. QSTAR Pulsar quadrupole TOF mass spectrometer, which was equipped with the Protana nanoelectrospray source. As peptides were eluted from the column they were focused into the mass spectrometer. The information-dependent acquisition (IDA) was used to acquire MS/MS. IDA mode was set to measure continuous cycles of full scan TOF MS from 400 to 1200 m/z plus three product ion scans from 50 to 4000 m/z. The data from IDA experiments were searched at MASCOT (www.matrixscience.com) MS/MS data search. The mass tolerance of both precursor ions and the MS/MS fragment ions was set at ±0.1 Da, and carbamidomethylcysteine was specified as a static modification. Phosphorylated Ser/Thr/Tyr and oxidized methionines were specified as variable modifications. All MS/MS spectra were manually analyzed to verify sequence assignments. Peaks with a minimum height of 3% relative to the base peak were considered, and a 100 ppm tolerance was used to establish matches with the theoretical b and y ions that were predicted with the help of Bioanalyst software (Applied Biosystems, Inc.).
Site-directed Mutagenesis
Site directed mutagenesis on phosphorylated serine residues of full-length HA-TR4, GST-TR4, GFP-TR4
LBD, and GST-TR4
LBD was performed using the QuikChange XL site-directed mutagenesis kit (Stratagene) following the manufacturers protocol. Replacement of phosphoserine residues with alanine and with glutamic acid were made by using mutagenic primers. The mutagenic primers were designed such that they were matched to nearest alanine or glutamic acid. The Ser/Thr
Ala point/sequential and Ser/Thr
Glu point/sequential mutations were referred to as the constitutive negative (CN) and the constitutive positive (CP) mutants, respectively. The mutagenic primers used to generate the mutant constructs are: S19A, 5'-CTCTGCGGTAGCCGCACCTCAGCGCATTC-3' (sense), and 5'-GAATGCGCTGAGGTGCGGCTACCGCAGAG-3' (antisense); S55A, 5'-GTTCATCCTAACCGCCCCAGATGGAGCTG-3' (sense) and 5'-CAGCTCCATCTGGGGCGGTTAGGATGAAC-3' (antisense); S68A, 5'-GTGATCCTGGCTGCTCCGGAAACATCC-3' (sense) and 5'-GGATGTTTCCGGAGCAGCCAGGATCAC-3' (antisense); S19E, 5'-CTCTGCGGTAGCCGAACCTCAGCGCATTC-3' (sense) and 5'-GAATGCGCTGAGGTTCGGCTACCGCAGAG-3' (antisense); S68E, 5'-GTGATCCTGGCTGAACCGGAAACATCC-3' (sense) and 5'-GGATGTTTCCGGTTCAGCCAGGATCAC-3' (antisense). The underlined characters indicate the genetic code for the mutant amino acid. The positive clones were verified by DNA sequencing.
RT-PCR and Western Blot
Total RNA was isolated from H235 cells using a TRIzol® kit (Invitrogen), and RT reaction was conducted using SuperscriptTM (Invitrogen) reverse transcriptase enzyme following the manufacturers protocol. The specific primers are 5'-CTA TGG GGC TGT CAG TTG TG-3' (sense) and 5'-CTC CTC CAC TGC TAT CTA TC-3' (antisense) to PCR amplify TR4 cDNA, 5'-TGT GGG CCG TGC TGT TGG TCA C-3' (sense) and 5'-TGC CTT GTA CAC AGC TAG GCG C-3' (antisense) to amplify cDNA of apoE gene, and actin-specific primers 5'-TGGCCTTAGGGTGCAGGG-3' (sense) and 5'-GTGGGCCGCTCTAGGCACCA-3' (antisense). The expression level of HA-TR4 was detected by anti-HA antibody (Santa Cruz Biotechnology), and TR4-
-LBD was detected using anti-TR4 antibody (Santa Cruz Biotechnology) in Western blot analyses.
Cell Culture, Transfection, and Reporter Assay
COS-1 cells were maintained in Dulbeccos modified Eagles medium supplemented with 10% FBS, and mouse hepatoma H2.35 cells were maintained in Dulbeccos modified Eagles medium containing 4% FBS and 20 nM dexamethasone. Transient transfection in cells was performed using LipofectamineTM 2000 (Invitrogen). In the reporter assay, 0.1 µg of expression plasmids (wild type TR4 full length, TR4-
LBD, and their mutants), control plasmids (pCMX/GFP empty vector), DR1-tk-luciferase (0.5 µg) reporter, and CMV-lacZ as an internal control (0.05 µg) were used in each well of 24-well plates. Thirty-two hours post-transfection cultures were fed a fresh medium containing dextran-charcoal-treated FBS and treated for 8 h with either 3 µM MAPK inhibitor (PD98059) or 1 µM anisomycin (MAPK activator) (Calbiochem). To monitor the effect of various cofactors on modulation of TR4 biological activity, the wild type TR4 full length and the TR4
LBD along with their mutants (0.1 µg) were introduced together with PCAF or RIP140 expression vector (0.1 µg) into cells. Forty hours post-transfection total cell extracts were collected and tested for luciferase and lacZ activities. The -fold relative luciferase activity was calculated by normalizing relative luciferase unit activity of the experimental groups to the relative luciferase unit activity of the empty vector control group.
GST Pulldown Assay
GST and GST fusion proteins were partially purified from bacteria by affinity chromatography using glutathione-agarose beads (Sigma). Preliminary binding studies were done for the various GST-TR4 constructs to determine the amount of bound sample that would yield approximately an equal amount of protein on a Coomassie-stained SDS-polyacrylamide gel. After binding, the beads were washed twice with 20 volumes of PBS and once with a binding buffer (20 mM HEPES (pH 7.5), 100 mM NaCl, 0.5 mM EDTA, 0.1% Triton X-100, 10% glycerol). 35S-Labeled PCAF or RIP140 (2 µl) prepared with the TNT kit (Promega) was then added to GST-TR4 samples in 300 µl of the binding buffer. The samples were incubated at 4 °C for 90 min followed by three washes with a 20-bead volume of the binding buffer. The beads were collected by centrifugation and suspended in the binding buffer (20 µl) and 4x SDS sample buffer (20 µl). Samples were divided into two parts, and an equal amount was resolved using SDS-PAGE (10% gel) on two separate gels. One gel was stained with Coomassie Blue, and the second gel was fixed, dried, and exposed to a PhosphorImager screen (GE Healthcare) overnight to detect the bound PCAF and RIP140 proteins.
| RESULTS |
|---|
|
|
|---|
|
Previously we have reported LC-ESI-MS/MS as a more efficient technique, as compared with MALDI-TOF-MS/MS, for the determination of Ser/Thr phosphorylation on nuclear corepressor RIP140. We identified 12 phosphorylation sites on RIP140 by applying this technique (18, 22). Therefore, we also used a similar LC-ESI-MS/MS analysis for the current TR4 study to identify its phosphorylation sites. The MS/MS data search on MASCOT revealed a 54% sequence coverage of the protein (Table I), covering mostly the N-terminal portion (spanning the AF-1 domain). We also used chymotrypsin digestion for the LC-ESI-MS/MS analysis, but this appeared to yield little improvement. However, an additional 6% coverage was added as shown in bold characters to the total coverage (54%) obtained by tryptic digestion, giving a final coverage of 60% (Table I).
|
|
|
The TIC of the modified peptide spanning aa 6575 displayed a doubly charged precursor ion at m/z 641.82 (precursor mass, 1281.63 Da) instead of the doubly charged precursor ion at m/z 601.84 (precursor mass, 1201.66 Da) of the unmodified version (Table II). The 80-unit mass difference between the two versions of the peptide predicted the modification by phosphorylation. The MS/MS spectrum of the doubly charged precursor ion of the modified peptide showed y ions from y1 through y7 identical to those of the unmodified version (Fig. 2C). However, these y ions, from y8 through y10 ions, which appeared at m/z 886.35, 957.39, and 1070.47, respectively (Fig. 2C, top panel), each clearly showed an 80-unit positive mass shift as compared with the unmodified peptide. Therefore, the phosphorylation site was assigned to Ser68.
Kinases Involved in TR4 Phosphorylation
Two sequence isoforms of TR4 (NCBI accession numbers U11688 (aa 1596) and S75970 (aa 1629)) have been documented with 33-amino acid (MATNMEGLVQHRVGTQQVAEVPRTQTSWPESPG) differences at the N terminus because of the presence of two potential translation initiation sites within the same reading frame. Our TR4 expression plasmid contained the complete cDNA for translating both variants. However, our mass data covered the sequence of the low molecular weight TR4 isoform (aa 1596, Table I). This could be due to the possibility that the low molecular weight TR4 variant was more abundantly expressed in the insect cells. Alternatively the N terminus of the large TR4 variant was not efficiently digested by trypsin for MS analysis. It would be important to explore in what physiological context a particular TR4 variant is preferentially expressed. It would also be equally important to determine the difference between the two variants in terms of their physiological functions. To identify the kinases involved in phosphorylation of its AF-1 domain, we conducted a kinase-specific consensus motif search. The consensus motifs for all known protein kinases (23) involved in the identified phosphorylation sites are shown in Table II. All three phosphorylation sites, at Ser19, Ser55, and Ser68, were potential targets for MAPK-mediated phosphorylation. Only Ser19 could be phosphorylated by other kinases such as Cdc2 protein kinase or Cdk2-cyclinA.
The Effects of MAPK on TR4 Activities
Because all phosphorylated residues confirmed by MS were potential sites for MAPK, we then focused on the role of MAPK-mediated phosphorylation in regulating the biological activity of TR4. To determine more comprehensively the biological activities of its AF-1, we used both the TR4 full-length protein and a TR4 construct devoid of LBD, named TR4
LBD, where potential complication from ligand binding could be avoided (Fig. 3A). A cell-based reporter assay containing a TR4-responding DR1 element (ATGGCAGAGGTCA) shown by underlined characters was used that was from its natural target in the mouse hepatic control region-1 of apoE/C-I/C-II gene cluster (Fig. 3B) (13). The MAPK activator/inhibitor was first used to determine the effects of MAPK pathway on the biological activity of the full-length TR4 and the TR4
LBD. As shown in Fig. 3B, both TR4 (5-fold) and TR4
LBD (4-fold) could activate the DR1 reporter, suggesting an LBD-independent activation of TR4. Furthermore MAPK activation by anisomycin led to a nearly complete loss of TR4 full-length protein activity and a significant reduction of TR4
LBD activity (AF-1) for the DR1 reporter. On the contrary, the inhibition of MAPK by PD98059 significantly increased the activation of the reporter by both constructs of TR4 (2.4-fold). Together these data revealed a role for MAPK-mediated phosphorylation in modulating the biological activity of TR4 that was independent of the effect of ligands or the LBD.
|
LBD proteins (Fig. 4). We generated CN (mimicking dephosphorylation) mutant by replacing phosphorylated Ser with Ala that cannot be phosphorylated by MAPK. Furthermore because one primary effect of protein phosphorylation is to increase site-specific negative charge of the protein, we generated CP (mimicking hyperphosphorylation) mutants of TR4 by replacing phospho-Ser residues, singly or in combination, with Glu. First we screened all three phosphorylated serine residues individually using the wild type, the CN, and the CP mutants in the context of both the full-length and the truncated proteins with regard to effects on the activation of the reporter. The data showed that the CN mutant of either Ser19 or Ser68 dramatically enhanced TR4 activation of the reporter as compared with the wild type TR4 full length (Fig. 4A, compare Wild and CN mutants). The activity of each individual CN mutant could be further enhanced by MAPK inhibition. However, the mutation on phospho-Ser55 to Ala had no effect on TR4 activity. The CN double mutant of both Ser19 and Ser68 robustly activated the reporter as compared with the wild type TR4 (Fig. 4A). Furthermore the inhibition of MAPK elicited no additional effect on this mutant, confirming that both phosphorylated Ser19 and Ser68 residues were essential for regulating the activity of TR4. The double CP (19CP+68CP) mutant repressed the reporter by 3-fold and 1012-fold as compared with the wild type TR4 and the CN (19CN+68CN) mutant, respectively. This result further supported the notion that hypophosphorylated TR4 acted as an activator, whereas the hyperphosphorylated TR4 functioned as a repressor, confirming that the activity of TR4 could be modulated by the coordination of its phosphorylation status.
|
LBD protein (Fig. 4B). It appeared that the CN mutation at Ser19/Ser68 enhanced the activity of TR4
LBD, whereas the CP mutations enhanced the repressive activity of this truncated protein that was devoid of LBD. Taken together, these data confirmed that TR4 activity could be modulated by the phosphorylation on the AF-1 domain (the N-terminal domain) independently of the potential effects of specific ligands. Genetic and biochemical studies demonstrated that TR4 could positively regulate the apoE gene expression (13). To test the effects of phosphorylation on TR4 activity in a physiological context, we conducted gain- and loss-of-function studies by expressing the TR4 wild type and mutants in mouse hepatoma H2.35 cells and monitoring its effect on endogenous target, apoE, gene expression (Fig. 4C). As expected, the CN mutant enhanced the expression of apoE gene as compared with the wild type. On the other hand, the CP mutant down-regulated the expression of apoE. These data were consistent with the findings using the DR1 reporter in terms of the effects of phosphorylation on the biological activity of TR4, verifying the physiological relevance of this finding. It was concluded that hypophosphorylated TR4 positively and hyperphosphorylated TR4 negatively regulated the expression of its target genes such as apoE.
The Effect of TR4 Phosphorylation on Its Interaction with Cofactors
To provide a mechanistic insight into the effects of phosphorylation on the regulatory activities of TR4, the potential coregulators of TR4 were evaluated. Both the wild type and the mutant were examined using the DR1 reporter in the presence of PCAF as a coactivator and RIP140 as a corepressor (Fig. 5A). It appeared that the wild type full-length TR4 activity was positively regulated by coactivator PCAF and negatively regulated by the corepressor RIP140. However, TR4
LBD activity was positively affected by PCAF but not affected by RIP140. This suggested that the activation of TR4 AF-1 domain was attributed to, at least in part, PCAF.
|
LBD robustly activated the DR1 reporter in the presence of PCAF. On the other hand, the CP mutant of the wild type TR4 repressed the reporter in the presence of RIP140, suggesting that the hyperphosphorylated TR4 preferentially recruited corepressor RIP140 to exert its repressive activity. Interestingly although the CP mutant of the TR4
LBD was also repressive, it was not affected by RIP140. This was consistent with the finding that RIP140 interacted with the LBD but not the AF-1 (see Fig. 5B). This could be due to reduced interaction with coactivator PCAF, or alternatively it could indicate a potentially different repressive mechanism mediated by other unidentified corepressors, which could specifically recognize the hyperphosphorylated AF-1 domain.
To determine whether the effect of TR4 phosphorylation on its biological activity was due to the effect on the recruitment of these coregulators, we carried out in vitro protein-protein interaction tests (Fig. 5B, left). The CP mutants were made in the context of GST fusions. To map the interacting domains of TR4 for different coregulators, we first tested the wild type TR4LBD (containing only LBD), the TR4
LBD (deleting the LBD), and the full-length proteins. As expected, the full-length TR4 interacted with both PCAF and RIP140. The data also clearly demonstrated that the LBD of TR4 did not interact with PCAF, whereas it strongly interacted with RIP140 (Fig. 5B, left). The TR4
LBD was found to interact strongly with PCAF but not with RIP140. These data were consistent with the findings in the cell-based assay, which also revealed the importance of the LBD for the corepressive function of RIP140 but not for the coactivating function of PCAF (Fig. 5A). The interaction tests were then conducted using mutants and the wild type (Fig. 5B, right). As expected, the wild type and the CN mutants of both TR4 and TR4
LBD, which should not be phosphorylated, preferentially interacted with PCAF. For the CP mutants of both TR4 and TR4
LBD, their interaction with PCAF was dramatically reduced, but the interaction of TR4 full-length CP mutant with RIP140 was enhanced.
Together the in vivo and in vitro data supported that the hyperphosphorylated TR4 preferentially recruited corepressor and the hypophosphorylated TR4 recruited coactivators. The effects of phosphorylation on the ability of TR4 to recruit coregulators were in agreement with the effects on its biological activities assessed in both the reporter and the natural target gene systems.
| DISCUSSION |
|---|
|
|
|---|
We identified three potential phosphorylated sites on TR4 from insect cells using LC-ESI-MS/MS analysis without any enrichment of the phosphopeptides. The phosphorylated sites were Ser19, Ser55, and Ser68, which were located in the AF-1 domain. All these residues were potential for MAPK phosphorylation according to the consensus motif analysis of TR4 for kinase specificity (see Tables I and II). However, some other sites, which could also be potential for MAPK-mediated phosphorylation, were not found according to the MS data as highlighted in Table I. However, we could not confirm the phosphorylation status of two residues located within the uncovered sequence of DBD and LBD. Furthermore a significant portion of the TR4 sequences in the LBD, DBD, and hinge regions was not covered by our PMF data using both trypsin and chymotrypsin for digestion. The theoretical digestion of TR4 showed very few putative digestion sites (Lys/Arg) in the LBD and many sites near the DBD and hinge regions in tryptic digestion. This could generate very large and small peptide fragments from LBD and DBD/hinge regions. These are usually difficult to detect by current MS facilities for PMF. However, the studies of our mutant proteins verified the significance of phosphorylation of the AF-1 domain per se, although it could not rule out potential contributions from the LBD and the DBD/hinge regions.
Certain nuclear receptors have been reported to interact with cofactors through their DBDs independently of their LBDs (29, 30). In this study, we have also shown that TR4 interaction with PCAF does not require LBD. Presumably the PCAF-interacting domain of TR4 is also located at the DBD. With respect to AF-1 function, a synergy has been shown for DBD-mediated cofactor interaction and AF-1 activity for progesterone receptors (31). Our data suggested that phosphorylation of AF-1 domain of TR4 antagonized the synergy between DBD and AF-1 function. Interestingly the transcriptional activity of another orphan receptor, TR2, is positively regulated by protein kinase C-mediated phosphorylation (15, 16), correlated with its enhanced interaction with PACF through the DBD. Because a significant portion of TR4 DBD region was not covered in our mass data, it is unclear whether any protein kinase C-mediated phosphorylation exists at the DBD region of TR4. To this end, it was noted that MAPK-mediated phosphorylation of AF-1 of PPAR-
enhanced its transcriptional activity, but MAPK-mediated phosphorylation of AF-1 of PPAR-
was shown to suppress its transcriptional activity (32). Thus, there seems to be no general rule for the biological manifestation of AF-1 phosphorylation. Given that AF-1 domain is the most divergent region among nuclear receptors (NRs), without structural information it is probably not a practical exercise to decipher how a single kinase-mediated phosphorylation at the AF-1 domain can differentially regulate the property and function of each receptor. The structural information about AF-1 is urgently needed.
Reversible protein phosphorylation is known to control a wide range of biological activities (79, 13, 33, 34). Many NRs have been found to be modified by phosphorylation (32). The biological activities of NRs are controlled, in many ways, by kinase signaling pathways. In this study, we described a bidirectional regulation of TR4 function by the MAPK-mediated phosphorylation. We addressed a specific ligand-independent activation of TR4 triggered by phosphorylation of its AF-1 domain. We found that phosphorylated TR4 recruits corepressor RIP140 to exert its repressive function, whereas the dephosphorylated TR4 preferentially recruits coactivator PCAF to activate the genes. Because activating and repressive activities of the full-length TR4 are higher as compared with the truncated TR4 devoid of the LBD (TR4
LBD) and AF-1 could modulate RIP140 binding to TR4 via its LBD, a synergy between AF-1 phosphorylation and AF-2 domain may exist to modulate the activity of TR4. This can be verified only if specific ligands for TR4 can be identified in the future.
As an orphan nuclear receptor, the physiological function of TR4 has been difficult to assess. Genetic knock-out studies have first indicated the involvement of TR4 in some vital physiological functions (79). For examples, TR4 regulates apolipoprotein E/C-I/C-II gene cluster (13), which is very actively involve in progression and regression of atherosclerosis and neuronal regeneration and degeneration processes. TR4 appears to be also essential for normal spermatogenesis, motor coordination, and cerebellum development (79). Our demonstration of a specific ligand-independent activating mechanism of TR4 mediated by MAPK-triggered phosphorylation as well as the identification of specific sites of phosphorylation provides an enormous opportunity for future studies of the molecular mechanisms mediating the biological activity of TR4 in numerous biological processes even without the presence of ligands.
| ACKNOWLEDGMENTS |
|---|
| FOOTNOTES |
|---|
Published, MCP Papers in Press, August 3, 2006, DOI 10.1074/mcp.M600180-MCP200
1 The abbreviations used are: TR4, testicular receptor 4; MAPK, mitogen-activated protein kinase; AF, activation function; DR, direct repeat; HA, hemagglutinin; GFP, green fluorescent protein; IDA, information-dependent acquisition; CN, constitutive negative; CP, constitutive positive; FBS, fetal bovine serum; PTM, post-translational modification; TIC, total ion chromatogram; aa, amino acids; LBD, ligand binding domain; DBD, DNA binding domain; PPAR, peroxisome proliferator-activated receptor; NR, nuclear receptor; PCAF, P300/cyclic AMP-responsive element binding protein-binding protein-associated factor. ![]()
* This work was supported by National Institutes of Health Grants DA11190, DA11806, DK54733, DK60521, and K02-DA13926 (to L.-N. W.). The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact. ![]()
Both authors contributed equally to this work. ![]()
To whom correspondence should be addressed: Dept. of Pharmacology, University of Minnesota Medical School, 6-120 Jackson Hall, 321 Church St. S.E., Minneapolis, MN 55455-0217. Tel.: 612-625-9402; Fax: 612-625-8408; E-mail: weixx009{at}umn.edu
| REFERENCES |
|---|
|
|
|---|
.
J. Steroid Biochem. Mol. Biol.
75, 147
148[CrossRef][Medline]This article has been cited by other articles:
![]() |
G. Li, Y.-F. Lee, S. Liu, Y. Cai, S. Xie, N.-C. Liu, B.-Y. Bao, Z. Chen, and C. Chang Oxidative Stress Stimulates Testicular Orphan Receptor 4 through Forkhead Transcription Factor Forkhead Box O3a Endocrinology, July 1, 2008; 149(7): 3490 - 3499. [Abstract] [Full Text] [PDF] |
||||
![]() |
K. D. Baker, R. B. Beckstead, D. J. Mangelsdorf, and C. S. Thummel Functional interactions between the Moses corepressor and DHR78 nuclear receptor regulate growth in Drosophila Genes & Dev., February 15, 2007; 21(4): 450 - 464. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
| All ASBMB Journals | Journal of Biological Chemistry |
| Journal of Lipid Research | ASBMB Today |