Table I

Protein sulfenic acids formed in isolated hearts treated with hydrogen peroxide

Band numberIdentificationMatching sequencesaMascot scorebMaxim decoy scorec
1MYH6_RAT; myosin heavy chain, cardiac muscle α isoformR↓SNAAAAALDKK↓Q31033
K↓EQDTSAHLER↓M
K↓LAEQELIETSER↓V
R↓LQDAEEAVEAVNAK↓C
R↓ILNPAAIPEGQFIDSR↓K
R↓NTLLQAELEELRAVVEQTER↓S
2MYH6_RAT; myosin heavy chain, cardiac muscle α isoformR↓VKLEEAQR↓S12629
R↓SNAAAAALDKK↓Q
R↓SLNDFTTQR↓A
K↓DNDDLELTLAK↓V
R↓ILNPAAIPEGQFIDSR↓K
3MYH6_RAT; myosin heavy chain, cardiac muscle α isoformR↓SLSTELFK↓L32932
K↓ANSEVAQWR↓T
R↓TKYETDAIQR↓T
R↓VKDALEKSEAR↓R
R↓LQDLVDKLQLK↓V
R↓NTLLQAELEELR↓A
K↓VKLEQQVDDLEGSLEQEKK↓V
R↓NTLLQAELEELRAVVEQTER↓S
K↓NLQEEISDLTEQLGEGGKNVHELEK↓I
4MYH6_RAT; myosin heavy chain, cardiac muscle α isoformR↓SLSTELFK↓L44732
R↓VKLEEAQR↓S
R↓SNAAAAALDKK↓Q
R↓LQDLVDKLQLK↓V
K↓VKLEQQVDDLEGSLEQEKK↓V
R↓NTLLQAELEELRAVVEQTER↓S
K↓NLQEEISDLTEQLGEGGKNVHELEK↓I
K↓QLEVEKLELQSALEEAEASLEHEEGK↓I
5MYH6_RAT; myosin heavy chain, cardiac muscle α isoformR↓SNAAAAALDKK↓Q32227
R↓TLEDQANEYR↓V
R↓NTLLQAELEELR↓A
R↓LQDAEEAVEAVNAK↓C
R↓IEELEEELEAER↓T
R↓NTLLQAELEELRAVVEQTER↓S
6gi|29727; cardiacβ myosin heavy chainK↓LASADIETYLLEK↓S3221
7ACTN2_MOUSE; α-actinin 2R↓HRPDLIDYSK↓L9516
R↓FAIQDISVEETSAK↓E
K↓LVSIGAEEIVDGNVK↓M
8gi|29727; cardiac β myosin heavy chainK↓LASADIETYLLEK↓S6625
gi|6755256; muscle glycogen phosphorylaseR↓YEFGIFNQK↓I58
R↓QIIEQLSSGFFSPK↓Q
9MYH7_RAT; myosin heavy chain, cardiac muscle β isoformK↓VGNEYVTK↓G11831
gi|10637996K↓LASADIETYLLEK↓S63
Mitochondrial aconitaseK↓SQFTITPGSEQIR↓A
R↓NAVTQEFGPVPDTAR↓Y
10ECHA_RAT; trifunctional enzyme α subunitK↓KLDALTTGFGFPVGAATLADEVGIDVAQHVAEDLGK↓A6220
11ODP2_RAT; dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complexK↓GLETIASDVVSLASK↓A4823
gi|219524; cardiac α myosin heavy chainR↓SNAAAAALDKK↓Q44
12gi|6754774; myosin heavy polypeptide 7, cardiac muscle, βR↓SNAAAAALDKK↓Q7629
K↓GTLEDQIIQANPALEAFGNAK↓T
13ATPB_RAT; ATP synthase β chainR↓FTQAGSEVSALLGR↓I5530
K↓VLDSGAPIKIPVGPETLGR↓I54
gi|109466092; 3-oxoacid CoA transferase 1K↓DGSVAIASKPR↓E
14ATPB_MOUSE; ATP synthase β chainR↓VVDALGNAIDGK↓G20820
R↓EAYPGDVFYLHSR↓L
R↓ILGADTSVDLEETGR↓V
R↓TGAIVDVPVGDELLGRVVDALGNAIDGKGPVGSK↓I
gi|50677; desminR↓TFGGAPGFSLGSPLSSPVFPR↓A
15KCRS_MOUSE; creatine kinaseK↓VPPPLPQFGR↓K9623
R↓SEVELVQIVIDGVNYLVDCEK↓K173
ACTC_MOUSE; actin, α cardiacR↓AVFPSIVGR↓A
K↓DSYVGDEAQSKR↓G
K↓SYELPDGQVITIGNER↓F
16TNNT2_RAT; troponin T, cardiac muscleR↓DAEDGPVEDSKPKPSR↓L15524
K↓DLNELQTLIEAHFENR↓K
K↓AKELWQSIHNLEAEKFDLQEK↓F
17MDHC_MOUSE; malate dehydrogenaseR↓VLVTGAAGQIAYSLLYSIGNGSVFGK↓D7726
17TPM1_MOUSE; tropomyosin 1 α chainR↓KLVIIESDLER↓A128
K↓SIDDLEDELYAQK↓L
18MDHC_MOUSE; malate dehydrogenaseK↓IQEAGTEVVK↓A8928
K↓IFGVTTLDIVR↓A
K↓ETECTYFSTPLLLGK↓K
19gi|1200100; malate dehydrogenaseK↓IQEAGTEVVK↓AK↓VAVLGASGGIGQPLSLLLK↓N7233
20gi|71620; actin βK↓AGFAGDDAPR↓A K↓SYELPDGQVITIGNER↓F8439
21ECHM_RAT; enoyl-CoA hydrataseK↓IFPVETLVEEAIQCAEK↓I6329
gi|56023; cardiac troponin IK↓NITEIADLTQK↓I58
R↓VDKVDEERYDVEAK↓V
gi|20071222; NADH dehydrogenase Fe-S protein 3K↓NITEIADLTQKIYDLR↓G
K↓SLADLTAVDVPTR↓Q35
22TPIS_MOUSE; triose-phosphate isomeraseK↓VVFEQTK↓V7417
K↓TATPQQAQEVHEK↓L129
gi|6981240; myosin, light polypeptide 3K↓AAPAPAAAPAAAPEPERPK↓E
K↓IKIEFTPEQIEEFKEAFQLFDR↓T
  • a Arrows indicate tryptic cleavage sites.

  • b Individual ion scores >57 indicate identity or extensive homology (p < 0.05).

  • c Maxim decoy score is the maximum score obtained by searching the same spectra against the randomized database using the same parameters.