Table I

Modified peptides identified by the Orbitrap and the associated MRM transitions for the dose-response experiment

ProteinPeptide(s)MRM transitionNeutral loss
Modified precursorInternal standards
TalinVVAPTISSPVCQEQLVEAGR (722–741)1058.04 → 1058.04415.26 → 415.26Yes (66 Da)
1058.04 → 1360.65415.26 → 629.40
1058.04 → 1029.531017.51 → 1017.51
1058.04 → 432.221017.51 → 1405.67
Glycoprotein 1bαLTQLNLDRCELTK (73–85)526.94 → 526.94591.82 → 591.82Yes (66 Da)
526.94 → 618.82591.82 → 785.39
526.94 → 545.27594.83 → 594.83
526.94 → 490.29594.83 → 662.38
VinculinREILGTCK (319–326)476.25 → 476.25553.31 → 553.31Yes (66 Da)
476.25 → 399.24553.31 → 905.49
476.25 → 569.34729.40 → 729.40
476.25 → 805.39729.40 → 531.35
Integrin β3IGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYK (177–217)937.64 → 937.64766.87 → 766.87No
937.64 → 894.94766.87 → 487.26
937.64 → 1348.59895.79 → 895.79
937.64 → 973.41895.79 → 1216.63
GelsolinLFACSNK (669–675)407.69 → 407.69444.25 → 444.25Yes (66 Da)
407.69 → 554.22444.25 → 530.33
407.69 → 348.19638.36 → 638.36
407.69 → 574.69638.36 → 940.52
Pyruvate kinase isozyme M1/M2NTGIICTIGPASR (44–56)667.84 → 667.84597.33 → 597.33Yes (66 Da)
667.84 → 701.39597.33 → 664.37
667.84 → 487.26754.44 → 754.44
667.84 → 430.24754.44 → 572.32
Adenylyl cyclase-associated protein 1NSLDCEIVSAK (423–443)605.79 → 605.79436.27 → 436.27Yes (66 Da)
605.79 → 646.38436.27 → 386.73
605.79 → 404.25606.84 → 606.84
605.79 → 305.18606.84 → 955.55
α-EnolaseVNQIGSVTESLQACK (344–358)804.90 → 804.90572.30 → 572.30Yes (66 Da)
804.90 → 455.26572.30 → 674.36
804.90 → 698.38713.37 → 713.37
804.90 → 928.47713.37 → 1149.58
ActinEKLCYVALDFEQEMATAASSSSLEK (214–238)933.43 → 933.431172.09 → 1172.09Yes (66 Da)
933.43 → 1147.031172.09 → 628.34
933.43 → 980.49505.92 → 505.92
933.43 → 808.40505.92 → 694.35
Actin-like protein 2VVVCDNGTGFVK (8–19)635.31 → 635.31366.21 → 366.21Yes (66 Da)
635.31 → 1071.48366.21 → 504.28
635.31 → 837.41332.53 → 332.53
635.31 → 608.34332.53 → 369.22
GAPDHVPTANVSVVDLTCRLEKPAK (235–254)753.38 → 753.38807.45 → 807.45Yes (66 Da)
753.38 → 703.85807.45 → 1003.56
753.38 → 924.45882.41 → 882.41
753.38 → 720.38882.41 → 596.28
Fructose-bisphosphate aldolase AALANSLACQGK (332–342)554.28 → 554.28666.86 → 666.86Yes (66 Da)
554.28 → 905.41666.86 → 907.44
554.28 → 776.36745.86 → 745.86
554.28 → 332.19745.86 → 1049.45
Malate dehydrogenaseVIVVGNPANTNCLTASK (126–142)866.95 → 866.95617.36 → 617.36Yes (66 Da)
866.95 → 582.36617.36 → 817.48
866.95 → 1151.54780.90 → 780.90
866.95 → 1214.58780.90 → 600.32
Twinfilin-2HLSSCAAPAPLTSAER (137–152)548.27 → 548.27572.27 → 572.27Yes (66 Da)
548.27 → 702.29572.27 → 800.39
548.27 → 941.51586.31 → 586.31
548.27 → 773.42586.31 → 765.88
l-Lactate dehydrogenaseVIGSGCNLDSAR (159–170)612.29 → 612.29457.29 → 457.29Yes (66 Da)
612.29 → 993.41457.29 → 701.43
612.29 → 675.34588.80 → 588.80
612.29 → 549.23588.80 → 689.36
14-3-3 ζ/δLAEQAERYDDMAACMK (12–27)954.89 → 954.891021.00 → 1021.00No
954.89 → 1480.641021.00 → 1114.54
954.89 → 1762.67774.86 → 774.86
954.89 → 571.22774.86 → 634.28
CalpainTDGFGIDTCR (136–145)558.74 → 558.74435.22 → 435.22No
558.74 → 508.21435.22 → 699.33
558.74 → 526.19889.40 → 699.33
558.74 → 591.28889.40 → 1062.47
Rac 3EIGSVKYLECSALTQR (148–163)914.96 → 914.96416.90 → 416.90No
914.96 → 1425.69416.90 → 539.80
914.96 → 517.31628.85 → 628.85
914.96 → 404.23628.85 → 950.49
GTP-binding protein SAR1aELNARPMEVFMCSVLKR (167–183)694.34 → 694.34573.83 → 573.83No
696.34 → 1425.69573.83 → 674.35
696.34 → 517.31709.90 → 709.90
696.34 → 404.23709.90 → 934.50
Rab 1aQVEVDCQQCMLEILDTAGTEQFTAMR (42–68)1003.12 → 1003.12493.31 → 493.31No
KQVEVDCQQCMLEILDTAGTEQFTAMR (41–68)1003.12 → 1456.67493.31 → 773.45
1003.12 → 1276.54833.46 → 833.46
1003.12 → 1056.48833.46 → 1194.96
1045.82 → 1045.82
1045.82 → 1321.59
1045.82 → 769.37
1045.82 → 494.24
ProfilinCSVIRDSLLQDGEFSMDLR (71–89)744.68 → 744.68416.90 → 416.90No
744.68 → 784.37416.90 → 539.80
744.68 → 660.32628.85 → 628.85
744.68 → 637.30628.85 → 950.49