Table II Observed signal peptide fragments and proposed cleavage sites to account for fragments detected

Peptide Mascot scores are provided in supplemental Table 7.

Gene IDObserved signal peptide fragmentsProposed cleavage sites for degradation of signal peptide
SACOL0480VGVLATGVVGYGNQADAMKFKKVLVATAM↓VGVLATGVVGYGNQADA
SACOL0723aFAITATSGAAAFLTHHDAQAMKKLA↓FAITATSGAAAFLTHHDAQA
SACOL0860VLTLVVVSSLSSSANAMTEYLLSAGICMAIVSILLIGMAISNVSKGQYAKRFFYFATSCL↓VLTLVVVSSLSSSANA
SACOL0908ALVLTTVGSGFHSSSNYNGINNVAKAMNKKLLTRTLIAS↓ALVLTTVGSGFHSSSNYNGINNVAKA
SACOL1062LTLVGSAVTAHQVQAMAKKFNYKLPSMVA↓LTLVGSAVTAHQVQA
SACOL1164AISLTVSTFAGESHAMKKNFIGKSILSIA↓AISLTVSTFAGESHA
SACOL1864TILTSITGVGTTMVEGIQQTAKAMNKNIIIKSIAAL↓TILTSITGVGTTMVEGIQQTAKA
SACOL1868TILTSVTGIGTTLVEEVQQTAKAMNKNVVIKSLAAL↓TILTSVTGIGTTLVEEVQQTAKA
SACOL2003ANLLLVGALTDNSAKAMVKKTKSNSLKKVATLAL↓ANLLLVGALTDNSAKA
SACOL2088aSLAVGLGIVAGNAGHEAHAMKKTLLAS↓SLAVGLGIVAGNAGHEAHA
SACOL2197LGLLSTVGAALPSHEASAMKLKSFVTATLA↓LGLLSTVGAALPSHEASA
SACOL2291AGFATIAIASGNQAHAMKKIATATIAT↓AGFATIAIASGNQAHA
SACOL2295aATTLTAGIGTALVGQAYHADAMKKLVT↓ATTL↓TAGIGTALVGQAYHADA
TAGIGTALVGQAYHADA
SACOL2418TITLATMISNGEAKAMKNKYISKLLVGAA↓TITLATMISNGEAKA
SACOL2421SVSLLAPLANPLLENAKAMLKNKILTTTL↓SVSLLAPLANPLLENAKA
SACOL2557AVLFSADFTYQSVEQTHQSHAMEYKKILIRLLIAF↓AVLFSADFTYQSVEQTHQSHA
SACOL2584aIMASSLAVALGVTGYAAGTGHQAHAMKKT↓IMA↓SSL↓AVALGVTGYAAGTGHQAHA
SSLAVALGVTGYAAGTGHQAHA
AVALGVTGYAAGTGHQAHA
SACOL2660GTLIGVTVVENSAPTSKQAQAMNKTSKVCVAATLAL↓GT↓LIGVTVVENSAPTSKQAQA
LIGVTVVENSAPTSKQAQA
  • a Stable cleaved signal peptide also identified in the extracellular medium by LTQ-FT-MS/MS analysis.