Table III Signal sequences and observed and predicted signal peptide cleavage sites of S. aureus COL proteins (secretory and cell wall-associated proteins) identified in present study
Gene IDSignal peptide with SPase Ia (−3 to −1)SPase I +1Cleavage site
Obsd. clvg. sitebSignalP 3.0SignalP 2.0PrediSiSigCleave
NNHMMNNHMM
SACOL0024MKALLLKTSVWLVLLFSVMGLWQVSNAAla27272727292727
SACOL0050MNKNSKKKLDFLPNKLNKYSIRRFTVGTASILVGATLIFGVANDQAEAAla48484848484848
SACOL0078MKKCIKTLFLSIILVVMSGWYHSAHASer26262626262626
SACOL0263MEDVLYMKKLTAAAIATMGFATFTMAHQADAAla31313129313131
SACOL0095MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAla36363636363636
SACOL0119MKKLATVGSLIVTSTLVFSSMPFQNAHAAsp28282828282828
SACOL0270MKKTILLTMTTLTLFSMSPNSAQATyr24242424242424
SACOL0303MNKISKYIAIASLSVAVTVSAPQTTNSTAFALys31313121312920
SACOL0317MLRGQEERKYSIRKYSIGVVSVLAATMFVVSSHEAQASer37373737373737
SACOL0442MFKKYDSKNSIVLKSILSLGIIYGGTFGIYPKADASer353535None35NoneNone
SACOL0480MKFKKVLVATAMVGVLATGVVGYGNQADALys2929292929None19
SACOL0507MQKKVIAAIIGTSAISAVAATQANAAla25252525252525
SACOL0610MINRDNKKAITKKGMISNRLNKFSIRKYTVGTASILVGTTLIFGLGNQEAKAAla52None5252525252
SACOL0669MKKLLTASIIACSVVMGVGLVNTSAEAAla27272727272727
SACOL0723MKKLAFAITATSGAAAFLTHHDAQASer25252523252525
SACOL0755MTVKNLFLGFVAVILTVCLIGLLILATNEDALALys33333333333333
SACOL0856MNMKKKEKHAIRKKSIGVASVLVGTLIGFGLLSSKEADASer39393939393939
SACOL0858MKKKLLVLTMSTLFATQIMNSNHAKASer26262624262426
SACOL0859MKRKVLVLTMGVICATQLWHSNHANALeu26262624332426
SACOL0860MTEYLLSAGICMAIVSILLIGMAISNVSKGQYAKRFFYFATSCLVLTLVVVSSL SSSANASer60232560306057
SACOL0886MKKLISILLINIIILGVSNSASAGln23232323232323
SACOL0887MNKIFRILTVSLFFFTFLIKNNLAYAAsp26262626262626
SACOL0907MYKRLFISHVILIFALILVISTPNVLAGlu27272727272727
SACOL0908MNKKLLTRTLIASALVLTTVGSGFHSSSNYNGINNVAKASer39243924393028
SACOL0962MTNSSKSFTKFMAASAVFTMGFLSVPTAGAGlu30303030303030
SACOL0985MKLKSFITVTLALGMIATTGATVAGNEVSAAla30303030303021
SACOL1056MNSSCKSRVFNIISIIMVSMLILSLGAFANNNKAKAAsp36363636363629
SACOL1062MAKKFNYKLPSMVALTLVGSAVTAHQVQAAla29292929292929
SACOL1071cMNKLLQSLSALGVSATLVTPNLNADAThr26262426242624
SACOL1071cMNKLLQSLSALGVSATLVTPNLNAAsp24262426242624
SACOL1140MTKHYLNSKYQSEQRSSAMKKITMGTASIILGSLVYIGADSQQVNAAla4639464646None46
SACOL1164MKKNFIGKSILSIAAISLTVSTFAGESHAGln29292929292929
SACOL1166MKKNITKTIIASTVIAAGLLTQTNDAKAPhe28282828282828
SACOL1168MKNKLIAKSLLTLAAIGITTTTIASTADASer29292929292926
SACOL1173MKTRIVSSVTTTLLLGSILMNPVANAAla26262626262626
SACOL1864MNKNIIIKSIAALTILTSITGVGTTMVEGIQQTAKAGlu36363636362924
SACOL1865MNKNIIIKSIAALTILTSVTGVGTTVVEGIQQTAKAGlu363636363636None
SACOL1866MNKNIIIKSIAALTILTSITGVGTTVVDGIQQTAKAGlu363636363636None
SACOL1867MNKNIVIKSMAALAILTSVTGINAAVVEETQQIANAGlu36252424362521
SACOL1868MNKNVVIKSLAALTILTSVTGIGTTLVEEVQQTAKAGlu36363636363636
SACOL1869MNKNVMVKGLTALTILTILTSLGFAENISNQPHSIAKAGlu38383838383023
SACOL1880MKMKKLVKSSVASSIALLLLSNTVDAAla26262626262626
SACOL1881MFKKKMLAATLSVGLIAPLASPIQESRAAsn28282828282828
SACOL2003MVKKTKSNSLKKVATLALANLLLVGALTDNSAKAGlu34343434343434
SACOL2004MIKQLCKNITICTLALSTTFTVLPATSFALys29292929292929
SACOL2006cMKNKKRVLIASSLSCAILLLSAATTQAAsn27272929292929
SACOL2006cMKNKKRVLIASSLSCAILLLSAATTQANSAla29272929292929
SACOL2019MSYHWFKKMLLSTSILILSSSSLGLATHTVEALys32323232323256
SACOL2088MKKTLLASSLAVGLGIVAGNAGHEAHASer27272723272727
SACOL2179MKKIFVIITTLLAVAIIIGSIIMVVFSQRQAQTPhe33313131293160
SACOL2197MKLKSFVTATLALGLLSTVGAALPSHEASAAsp30303030303030
SACOL2291MKKIATATIATAGFATIAIASGNQAHASer27272727272727
SACOL2295MKKLVTATTLTAGIGTALVGQAYHADAAla27272727272227
SACOL2418MKNKYISKLLVGAATITLATMISNGEAKASer29292927292929
SACOL2419MIKNKILTATLAVGLIAPLANPFIEISKAGlu29292929292929
SACOL2421MLKNKILTTTLSVSLLAPLANPLLENAKAAla29292929292929
SACOL2422MKMNKLVKSSVATSMALLLLSGTANAGlu26262626262626
SACOL2557MEYKKILIRLLIAFAVLFSADFTYQSVEQTHQSHAAla3535352635None19
SACOL2584MKKTIMASSLAVALGVTGYAAGTGHQAHAAla29292929292929
SACOL2660MNKTSKVCVAATLALGTLIGVTVVENSAPTSKQAQAAla36363627362736
SACOL2694MKSQNKYSIRKFSVGASSILIATLLFLSGGQAQAAla34343434343434
  • a Residues at positions −3 to −1 relative to the verified SPase I cleavage sites are shown in bold.

  • b Signal peptide cleavage site positions were experimentally determined by whole protein MS analysis, peptide MS/MS analysis (identification of the N-terminal peptide of the mature protein), or both.

  • c Proteins with signal peptide cleavages at more than one site.