Table IV Peptides identified by LC-MS/MS analysis and database search in the venom of BC collected in the presence of proteinase inhibitors using a database compiled from de novo sequenced peptides (supplemental Peptide Database)
Venom treatmentPeptideProtein scoream/zzPeptide scorebSequence
EDTABPP-12d60627.9218<ENWPHPPMPPA
676.3230<ENWPHPPMPPAP
684.4222<ENWPHPPMPPAP; oxidation (M)
BPP-10e putative sequence 160566.9239<ENWPSPKVPP
BC 39 aa putative LAAO fragment 933787.4433AGEYTAKAHGWIDSTIKSRDAARDVNRAS
PMSFBC 39 aa putative LAAO fragment 9394787.4495AGEYTAKAHGWIDSTIKSRDAARDVNRAS
659.6529FAGEYTAKAHGWIDSTIKSRDAARDVNRAS
689.0528FFAGEYTAKAHGWIDSTIKSRDAARDVNRAS
839.4572TEPVVINFFAGEYTAKAHGWIDSTIKSRDAARDVNRAS
862.05121ITEPVVINFFAGEYTAKAHGWIDSTIKSRDAARDVNRAS
BPP-10e putative sequence 168566.9239<ENWPSPKVPP
BF 14 aa putative LAAO fragment 257852.4243TTFTPYQFKHFSEA
BPP-12d40592.4217<ENWPHPPMPP
676.4223<ENWPHPPMPPAP
684.4219<ENWPHPPMPPAP; oxidation (M)
EDTA+PMSFBC 39 aa putative LAAO fragment 9151787.42470AGEYTAKAHGWIDSTIKSRDAARDVNRAS
862.05599ITEPVVINFFAGEYTAKAHGWIDSTIKSRDAARDVNRAS
BPP-12d46627.91215<ENWPHPPMPPA
676.33223<ENWPHPPMPPAP
684.4228<ENWPHPPMPPAP; oxidation (M)
BPP-10e putative sequence 143566.9225<ENWPSPKVPP
WaterBC 39 aa putative LAAO fragment 9330787.4494AGEYTAKAHGWIDSTIKSRDAARDVNRAS
839.4593TEPVVINFFAGEYTAKAHGWIDSTIKSRDAARDVNRAS
862.0596ITEPVVINFFAGEYTAKAHGWIDSTIKSRDAARDVNRAS
BPP-12d33620.9214NWPHPPMPPAP
627.9217<ENWPHPPMPPA
676.4224<ENWPHPPMPPAP
BPP-10e putative sequence 126566.9226<ENWPSPKVPP
  • a MASCOT score for the identification considering the whole peptide entry listed in the database.

  • b MASCOT score for the single peptide or peptide fragment identified.