Table I Conotoxins identified via confident MS/MS analysis
SuperfamilycDNAPrecursor sequenceConotoxin sequenceConotoxin nameMonoisotopic mass (MH+)Mass deviation (ppm)MS/MS spectra
AFla1.3/1.4/1.5MGMRMMFTMLLLVVLATTVVSFTLDHAFDGRN(I/T)AANNKATDLMALPVRGCCSDPPCRHKHQDLCG↓CCSDPPCRHKHQDLC*fla1a1968.79962.44Supplemental Fig. S3
AGCCSDPPCRHKHQDLC*fla1b2025.81853.65Supplemental Fig. S4
BFla-5MQLYTHLYLLVPLVAFHLILGTGTLAHGDALTERRSADATALKPEPVLLQKSAARSTDDNDRDRLTQRKRILKKQGNMARGYEEDREIAETIRELNEAGKGYEEDREIAETIREL↓ (four of these five Glu residues are carboxylated, the positions of which are not identified)Conantokin-fla1998.83791.58Supplemental Fig. 2A
LFla14.3MKLSVTFIVVLMLTTSLTFGFSLSSNNGERAYGSHHSYVADQLVRRERASRACNPPCSDILTCLHGTCKHLGIGACNPPCSDILTCLHGTCKHLGI*fla14a2523.16572.64Supplemental Fig. S5
LACNPOCSDILTCLHGTCKHLGI*fla14b2539.15883.31Supplemental Fig. S6
LACNOOCSDILTCLHGTCKHLGI*fla14c2555.15323.50Supplemental Fig. S7
LFla14.2MKLSVTFIVVLMLTTSLTFGFSLSSNNGERAYGPRHSNVADQLVPREQASRTCYPPCIGYTYCKSGTCEYRQGRASTVFLKRQTCYPPCIGYTYCKSGTCEYRQ*fla14d2663.10403.94Supplemental Fig. S8
MFla3.4MMSKLGVLLTISLLLFPLTAVQLDGEQPVDLLALRTQDFAPEQSPWFDPVKRCCSKYCWECTPCCPYSSGCCSKYCWECTOCCPYSS*fla3a2319.79524.41Supplemental Fig. S9
MLv3-V04MLKMGVVLFTFLVLFPLATLQLDADQPRARYAENKQDFNRNERTKMILSAVSASMGRQRRCCLWPACWGCVCCY↓RCCLWPACWGCVCCYfla3b2017.78302.66Supplemental Fig. S10
MFla3.2/3.3MLKMRVVLFTFLVLFPLATLQLDADQPRARYAENKQDFNRNERTKMILSAVSASMGRQRRCCLWPECGGCVCCY↓RCCLWPECGGCVCCYfla3c2036.72943.47Supplemental Fig. S11
M↓RCCLWPγCGGCVCCYfla3d2080.72102.44Supplemental Fig. S12
O1Fla-17MKLTCILIVAVLFSTAWTFVTVDDSINHLKYREWTDFRPWGKRIPEARDKMKNLKFSKLDNKKRRLEWTDFRPW*fla011135.52892.71Supplemental Fig. S13
O1γWTDFRPW*fla021179.51922.16Supplemental Fig. S14
O1Fla-18MKLTCVMIVAALFLTAWTFVTADNSKYELENRGGLGHAGGWVKAGALGKDPGWGKRFLMARDEMKNPKASKLVPGGLGHAGGWVKAGALG↓fla031407.74463.22Supplemental Fig. S15
O1GGLGHAGGWVKAGALGKDPGW*fla041990.03035.13Supplemental Fig. S16
O1GGLGHAGGWVKAGALGKDPGWfla051991.02500.26Supplemental Fig. S17
O1↓LGHAGGWVKAGALGKDPGW*fla061875.99013.97Supplemental Fig. S18
O1↓HAGGWVKAGALGKDPGW*fla071705.88673.15Supplemental Fig. S19
O1//SCGHSGAGCYSRPCCPGLHCSGTHAGGVCVfla6e3205.26351.89Fig. 2B
O1Fla6.4MKLMCVLIIAVLFLTASQLITADYSRDKQEYRAERLRDAMGKFKGSRSCGHSGAGCYTRPCCPGLHCSGGQAGGLCVSCGHSGAGCYTRPCCPGLHCSGGQAGGLCVfla6a3180.25635.66Supplemental Fig. S20
O1SCGHSGAGCYTROCCPGLHCSGGQAGGLCVfla6b3196.25574.23Supplemental Fig. S21
O1SCGHSGAGCYTROCCOGLHCSGGQAGGLCVfla6c3212.24675.44Supplemental Fig. S22
O1Fla6.5MKLTCALIVAMLFLTACQLTTTDDSRGRQKYPTERLRVKMRNPKLSKLTKTCDPPGDSCSRWYNHCCSKLCTSRNSGPTCSRPTCDPOGDSCSRWYNHCCSKLCTSRNSGOTCSRPfla6d3992.59911.33Supplemental Fig. S23
TFla5.2MRCVPVFIILLLLSPSAPSVDAHPKTKDDVPLASFHDDAKRTLQRLWIKALCCYGYAFCCRLGRALCCYGYAFCCRL*fla5a1712.71043.52Supplemental Fig. S24
T↓LCCYGYAFCCRL*fla5b1641.67462.85Supplemental Fig. S25
TLiC121 (P01681)MRCVPVFIILLLLSPSAPSVDAHPKTKDDVPLASFHDDAKRTLQRLWIKALCCYGYRFCCPNFRALCCYGYRFCCPN↓fla5c1740.66664.82Supplemental Fig. S26
VFla15.7MSTPKMTPFILLLLFSLTIRCGDGKAIQEDRDPSTRLLTGDKNRDLSVNRRCSSCNGEICCGSCFCFPHGKNCFCRQLGK↓SCFCFPHGKNCFCRQL*fla15a2116.90103.52Fig. 3
QFla16.1/16.2MHTLEMLLLLLLLLPLAPGEGDGQAVAGDRNPSEARSTHEHFLQRLIRLIHGSDCQPCGQYVCCPPWKYAEYRRFTLIHGSDCQPCGQYVCCPPWKY↓fla16a2625.10473.59Fig. 4A
QLIHGSDCQPCGQYVCCPPWKYA↓fla16b2696.14083.86Fig. 4B
QLIHGSDCQPCGQYVCCPPWKYAE↓fla16c2825.18393.53Fig. 4C
QLIHGSDCQPCGQYVCCPPWKYAEYfla16d2988.24813.04Fig. 4D
  • Notes: O represents hydroxylated proline, and γ is the carboxylated glutamate residue. C-terminal amidation is denoted by an asterisk. Arrows indicate the unexpected proteolytic cleavage.