Table III

Prediction of signal peptides in proteins identified in the plasma membrane of Synechocystis

aa represents the number of amino acids in the signal peptide, hydrophobic regions are underlined, cleavage sites are represented by -, twin arginines are in bold, and Sec-avoidance is in italic.

ORFGene productSignal sequenceaa
Sec signal
Slr0013HypotheticalMKLIDSRGRIFGIVSLLDLGAALIILMVAVGIFVLPGSSGKSILAQANA-AS49
Slr0431HypotheticalMRPKFFSRRPT41
M*GISKLSKFSASVLLSGAILTTLPPSPLWA-NE30a
Slr1258HypotheticalMSTIKALLPPKFPQLLTGLALLSLSLVVSTAIA-AK33
Slr1270TolCMKSIHPLKFWSSSTLLLLLSTSVGVFLPGFSGGQGAIAVA-QS40
Slr1624HypotheticalMLDRHWHNQNNCRPSYWSHVTTVLTICLLAIAMGLGGCQSLSA-SS43
Slr1751Carboxyl-terminal protease CtpCMLKQKRSLILGTTALLLTTVAVT-GV23
Slr1841Putative porinMLKLSWKSLLVSPAVIGAALVAGAASA-AP27
Slr1908Putative porinMNKLTSHLLKLFPLALGSSLAIVPGAMA-QS28
Sll0427PsbOMRFRPSIVALLSVCFGLLTFLYSGSAFA-VD28
Sll0749HypotheticalMEKIMSEQKSSSSLTGFALAALMVALVGTGFAF-WT32
Sll0813Cytochrome c oxidase subunit II CoxBMSRKNLILLAVYIVFTVGASLWLGQRAYQWLPPAAA-QE36
Sll0819PsaFMKHLLALLLAFTLWFNFAPSASA-DD23
Sll1835HypotheticalMATHNLDRVAAPLISKLFPFFLVLAGMFSGTLAAQA-QG36
TAT signal
Slr0447Putative periplasmic binding proteinMTNPFGRRKFLLYGSATLGASLLLKA-CG26
Slr0513Periplasmic iron-binding protein FutA2MTTKISRRTFFVGGTALTALVVANLPRRASA-QS31
Slr1506Hypothetical (Met-46 as start)MVTFPLNLRRWLQSVCLGALTAIA-VQ24
Lipoprotein
Slr0695HypotheticalMRKRLTRFLSLALVLGLLWFGTAA-CASQP24
Slr1295Periplasmic iron-binding protein FutA1MVQKLSRRLFLSIGTAFTVVVGSQLLSS-CGQSP28
Slr1319Iron(III) dicitrate periplasmic binding protein FecBMKSKLIIFTFCLVLFG-CAKQV16
Slr1897SrrAMVSWCRWRSPRRWFLFACLGLLLSGLIS-CQSNS28
Sll0141Membrane fusion proteinMNKYIPHQRLRRQLSLLGLLSFSLMG-CSDLW26
Sll0180Membrane fusion proteinMVRKRSQFPVIGSMVALALLNTA-CGGDK25
Slr0040Bicarbonate transporter substrate-binding protein CmpAMGSFNRRKFLLTSAATATGALFLKG-CAGNP25
Sll1638HypotheticalMSRLRSLLSLILVLVTTVLVS-CSSPQ22
Sll1699Periplasmic oligopeptide-binding proteinMRWGNKVAM*SRVAGQRKTAIAREKNPGQQNYLSGRSWGQKLIS-57
ALLCCLALTFSLGG-CFSPE49a
  • a Assuming that the second methionine represents the real translational starting point.