Table II

A list of tryptic peptides in Frigg where exact phosphorylation sites were localized by mass spectrometry

The table lists tryptic peptides derived from Frigg with the specific phosphorylation sites identified by MS/MS marked in bold. Residue numbers correspond to the position of the indicated phosphorylated residue within Frigg sequence.

Phosphorylated amino acidTryptic peptide
Ser-12LTRYSQGDDDGSSSSGGSSVAGSQSTLFK
Ser-54RLSPAPQLGPSSDAHTSYYSESLVHESWFPPR
Ser-116GTGGSESSRASGLVGR