Table II

EGF receptor peptides identified by LC-MS/MS and MALDI methods using multiple search engines, ProID/ProICAT, SONAR, and Mascot for fragment ion spectra and Knexus for MALDI data (<30 ppm)

Epidermal growth factor receptor peptidesProID confidence (%)ProID scoreSONAR exp valueMascot scoreSequence positionMALDI <30 ppm
ACGADSYEMEEDGVR99561.5 × 10−480286–300+
ACGADSYEMEEDGVRK99501.1 × 10−638286–301
ANKEILDEAYVMASVDNPHVCR9821731–752
ATGQVCHALCSPEGCWGPEPR99382.7 × 10−536477–497+
CEGPCR9911305–310
CEGPCRK9514305–311
CNLLEGEPR99221.1 × 10−245515–523+
CWMIDADSRPK (and/or erbB4)99373.0 × 10−450926–936+
DCVSCR99147.6 × 10−1498–503+
DEATCK9915232–237
DEATCKDTCPPLMLYNPTTYQMDVNPEGK4.9 × 10−3232–260
DNIGSQYLLNWCVQIAK (pY789)99428.6 × 10−440783–799+
DPHYQDPHSTAVGNPE(pY)LNTVQPTCVNSTFDSPAHWAQK (pY1114)999111098–1136
DPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQK9994.9 × 10−3111098–1136
EAKPNGIFKGSTAENAE(pY)LR (P1: 1173)99253.8 × 10−11156–1175
EAKPNGIFKGSTAENAEYLR99346.1 × 10−41156–1175
ECVDKCNLLEGEPR99317.0 × 10−137510–523
EDSFLQR99324.0 × 10−1431038–1044+
EHKDNIGSQYLLNWCVQIAK99302.2 × 10−344780–799
EILDEAYVMASVDNPHVCR99604.6 × 10−876734–752+
EISDGDVIISGNK99362.8 × 10−259431–443+
ELIIEFSK99411.4 × 10−146939–946+
ELVEPLTPSGEAPNQALLR99423.4 × 10−2265663–681+
ESDCLVCR99141.7 × 10−020221–228+
ESDCLVCRK9816221–229
EYHAEGGKVPIK99331.1 × 10−2844–855
FRDEATCK99401.9 × 10−216230–237
FRELIIEFSK993444937–946+
FSNNPALCNVESIQWR99554.3 × 10−675126–141+
GDSFTHTPPLDPQELDILK99463.7 × 10−3046354–372+
GENSCK99133.7 × 10−111471–476
GLWIPEGEK99481.2 × 10−128705–713+
GLWIPEGEKVK99282.3 × 10−2705–715
GMNYLEDR99406.2 × 10−348800–807+
GNMYYENSYALAVLSNYDANK99362.2 × 10−45785–105
GNMYYENSYALAVLSNYDANKTGLK993085–109
GPDNCIQCAHYIDGPHCVK99319.2 × 10−321551–569
GRECVDK98321.2 × 10−1508–514
GSHQISLDNPD(pY)QQDFFPK (P2: 1148)9940361137–1155+
GSHQISLDNPDYQQDFFPK99461.4 × 10−3421137–1155
GSTAENAE(pY)LR (P1: 1173)99281165–1175+
GSTAENAEYLR99325.0 × 10−2411165–1175
IICAQQCSGR99247.0 × 10−2189–198+
IISNRGENSCK9924466–476
IKVLGSGAFGTVYK99406.8 × 10−531691–704
ILKETEFK9927682–689
IPLENLQIIR99552.1 × 10−316075–84+
IPSIATGMVGALLLLLVVALGIGLFMR98171.0 × 10+3619–645
ITDFGLAK99446.0 × 10−254829–836+
IYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEK991726866–905
KCEGPCR9920304–310
KVCNGIGIGEFK99561.1 × 10−453311–322+
KVCQGTSNK99213.8 × 10−220005–013
LLQERELVEPLTPSGEAPNQALLR9932658–681
LPQPPICTIDVYMIMVK (pY920; and/or erbB2)99376.7 × 10−441909–925
LTQLGTFEDHFLSLQR99484.8 × 10−6261014–029+
MHLP(pS)PTDSNFYR (pS967)9927963–975+
MHLPSPTDSNF(pY)R (pS974)9929963–975+
MHLPSPTDSNFYR99441.7 × 10−251963–975+
NGLQSCPIK99201029–1037
NGLQSCPIKEDSFLQR99552.3 × 10−5401029–1044+
NLCYANTINWK99421.5 × 10−336444–454
NLCYANTINWKK99408.0 × 10−2444–455
NLQEILHGAVR99511.6 × 10−4165115–125+
NVLVKTPQHVK99375.0 × 10−3818–828
NYDLSFLK99322.8 × 10−142049–056+
NYDLSFLKTIQEVAGYVLIALNTVER9929049–074
NYVVTDHGSCVR99567.2 × 10−530274–285+
RPAGSVQNPV(pY)HNQPLNPAPSR (P4: 1086)9975461076–1097+
RPAGSVQNPVYHNQPLNPAPSR99606.6 × 10−6501076–1097+
SLKEISDGDVIISGNK99524.9 × 10−458428–443+
SPSDCCHNQCAAGCTGPR9928203–220
TDLHAFENLEIIR99553.9 × 10−3260428–443+
TIQEVAGYVLIALNTVER99601.0 × 10−486057–074+
TPLLSSLSATSNNSTVACIDR99602.4 × 10−5911008–1028
VAPQSSEFIGA9721171176–1186
VCNGIGIGEFK99476.3 × 10−456312–322+
VCQGTSNK90308.0 × 10−228006–013
VKIPVAIK99386.0 × 10−234714–721
VLGSGAFGTVYK (also erbB2)99554.2 × 10−4275693–704+
VLGSGAFGTVYKGLWIPEGEK (pY703)9927693–713
VPIKWMALESILHR993753852–865
WMALESILHR99449.5 × 10−648856–865+
YLVIQGDER (pY964)99463.0 × 10−2251954–962+
YSFGATCVK99262.0 × 10−3335261–269+
YSFGATCVKK99251.5 × 10−415261–270
YSSDPTGALTEDSIDDTFLPVPEYINQSVPK99275.0 × 10−31045–1097