Table III

Phosphopeptides identified by LC-MS/MS with percent confidence, score, best ScanSite motif prediction and identified nonphosphorylated peptide counterparts

Phosphoprotein (residue)PeptideConfidence (%)ScoreScanSite (percentile)
Paxillin
    pY118VGEEEHV(pY)SFPNK9942Crk-SH2 (0.24%)
VGEEEHVYSFPNK9944
    pY88FIHQQPQSSSPV(pY)GSSAK9936Src (3.3%)
FIHQQPQSSSPVYGSSAK9940
p130CAS
    pY249HLLAPGPQDI(pY)DVPPVR9921Crk-SH2 (0.01%)
    pY306GLPPSNHHAV(pY)DVPPSVSK9928Nck_SH2 (0.05%)
    pY387RPGPGTL(pY)DVPR9930Abl (0.01%)
    RPGPGTLYDVPR9932
EGF receptor
    pY1173 P1EAKPNGIFKGSTAENAE(pY)LR9925EGFr (0.05%)
EAKPNGIFKGSTAENAEYLR9934
    pY1173 P1GSTAENAE(pY)LR9928EGFr (0.05%)
GSTAENAEYLR9932
    pY1148 P2GSHQISLDNPD(pY)QQDFFPK9940EGFr (0.23%)
GSHQISLDNPDYQQDFFPK9946
    pY1086 P4RPAGSVQNPV(pY)HNQPLNPAPSR (P4: 1086)9975EGFr (1.05%)
RPAGSVQNPVYHNQPLNPAPSR (P4: 1086)9960
    pY1114DPHYQDPHSTAVGNPE(pY)LNTVQPTCVNSTFDSPAHWAQK999EGFr (0.04%)
DPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQK999
    pY974MHLPSPTDSNF(pY)R9925
MHLPSPTDSNFYR9944
    pS967MHLP(pS)PTDSNFYR9927p38MAPK (1.40%)
MHLPSPTDSNFYR9944