Table III

List of peptides identified by MS/MS for histone H2A contained in the first and second HPLC peaks

ProteasesResiduesMassSequencesaVariantsb
CalculatedMeasured
Da
First HPLC peak
    Glu-C1–414476.54476.77SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAEH2AO/Q
    Glu-C1–414518.514518.73SGRGacKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAEH2AO/Q
    Glu-C1–414556.464556.65pSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAEH2AO/Q
    Glu-C42–561502.791502.76RVGAGAPVYMAAVLEH2AO/Q
    Glu-C60–67936.47936.48YLTAEVLEH2AZ
    Glu-C57–64950.49950.5YLTAEILEH2AO/Q
    Glu-C93–1213054.853054.83LNKLLGKVTIAQGGVLPNIQAVLLPKKTEH2AO/Q
    Glu-C65–923211.763211.78LAGNAARDNKKTRIIPRHLQLAIRNDEEH2AO/Q
    Glu-C68–953127.753127.71LAGNASKDLKVKRITPRHLQLAIRGDEEH2AZ
    Glu-C96–1273306.943306.96LDSLIKATIAGGGVIPHIHKSLIGKKGQQKTVH2AZ
    Arg-C1–111142.621142.64SGRGKQGGKARH2AO/Q
    Arg-C1–111184.631184.64SGRGacKQGGKARH2AO/Q
    Arg-C1–191816.021816.08AGGKAGKDSGKAKTKAVSRH2AZ
    Arg-C1–191858.031858.08AGGacKAGKDSGKAKTKAVSRH2AZ
AGGKAGacKDSGKAKTKAVSR
    Arg-C1–191900.041900.08AGGacKAGacKDSGKAKTKAVSRH2AZ
    Arg-C82–1295247.015247.22HLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGKH2AO
    Arg-C82–1285139.965140.01HLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKSKH2AQ
    Arg-C85–1274568.594568.49HLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTVH2AZ
Second HPLC peak
    Glu-C1–414476.54476.89SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAEH2AL
    Glu-C1–414490.514490.89SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAEH2AC/E/Q96KK5
    Glu-C1–414506.514506.33SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSEH2AA/G
    Glu-C1–414532.524532.81SGRGacKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAEH2AC/E/Q96KK5
    Glu-C1–414570.474570.25pSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAEH2AC/E/Q96KK5
    Glu-C42–561484.831484.83RVGAGAPVYLAAVLEH2AA/C/E/G/L/Q96KK5
    Glu-C57–64950.49950.49YLTAEILEH2AA/C/E/G/L/Q96KK5
    Glu-C65–923211.763212.08LAGNAARDNKKTRIIPRHLQLAIRNDEEH2AA/C/E/G/L/Q96KK5
    Glu-C93–1213054.853054.85LNKLLGKVTIAQGGVLPNIQAVLLPKKTEH2AC/E/G/Q96KK5
    Glu-C93–1213082.853082.97LNKLLGRVTIAQGGVLPNIQAVLLPKKTEH2AA/L
    Arg-C1–111142.621142.64SGRGKQGGKARAll
    Arg-C1–111184.631184.64SGRGacKQGGKARAll
    Arg-C1–111222.581222.6pSGRGKQGGKARAll
    Arg-C1–171798.031798.04SGRGKQGGKARAKAKTRH2AA/C/G/E/Q96KK5
    Arg-C1–171840.041840.04SGRGacKQGGCARAKAKTRH2AA/C/G/E/Q96KK5
    Arg-C1–171877.991878.02pSGRGKQGGKARAKAKTRH2AA/C/G/E/Q96KK5
    Arg-C1–171784.021784.04SGRGKQGGKARAKAKSRH2AL
    Arg-C1–171826.031826.04SGRGacKQGGKARAKAKSRH2AL
    Arg-C1–171863.981864.32pSGRGKQGGKARAKAKSRH2AL
    Arg-C82–1295247.015247.21HLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGKH2AC/G
    Arg-C82–1295275.015274.11HLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGKH2AA/L
    Arg-C89–991299.671299.69NDEELNKLLGRH2AA/L
    Arg-C100–1293161.833161.91VTIAQGGVLPNIQAVLLPKKTESHHKAKGKH2AA/L
    Arg-C82–1275091.915092.05HLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKTKH2AE
    Arg-C82–1275061.895061.99HLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKQ96KK5
  • a Bold amino acids represent residues that vary in the sequence, acK indicates a monoacetylation on Lys, and pS indicates a phosphorylation on Ser.

  • b List of histone H2A variants identified in the protein mixtures with the same corresponding sequences.