Table I

Proteins bound to ARF6 GTPase identified by mass spectrometry

Proteins bound to ARF6Q67L affinity matrix were fractionated by SDS-PAGE as illustrated in Fig. 1A. Individual bands were removed for in-gel digestion, and the resulting peptides were identified by MALDI-TOF and LC-MS/MS mass spectrometric analyses. The protein names, their predicted molecular mass in Da (MM), and their NCBI accession numbers are indicated. The protein probability score, sequence coverage, sequenced peptides, number of peptides matched, and the total number of peptides detected are also listed.

Band no.NCBI accession no.MMProtein identifiedProtein probability scoreSequence coverage and sequenced peptidesNo. of matchedPeptides detected
P2 gi|12408656 81,838Calpain I5.3e−01122.1%1421
HENAIK
YLGQDYEQLR
LVFVHSAEGNEFWSALLEK
VNGSYEALSGGSTSEGFEDFTGGVTEWYELRK
LEICNLTPDALK
NYPATFWVNPQFK
ESGCSFVLALMQK
ARSEQFINLR
ARSEQFINLREVSTR
SEQFINLR
SEQFINLREVSTR
FRLPPGEYVVVPSTFEPNKEGDFVLR
EFSEK
SMVNLMDRDGNGK
P3 gi|38570142 77,246PALS16.0e−00619.7%1117
EMAVDCPGDLGTR
ARDIPLGATVR
NEMDSVIISR
SGLLHEGDEVLEINGIEIR
AHFDYDPSDDPYVPCR
EGDEDNQPLAGLVPGK
FASAVPHTTR
DYHFVSR
QAFEADIAAGK
FIEHGEFEK
NLYGTSIDSVR
P4 gi|46249758 67,332Ezrin3.7e−00839%1937
PKPINVRVTTMDAELEFAIQPNTTGK
VTTMDAELEFAIQPNTTGKQLFDQVVK
TIGLREVWYFGLHYVDNK
EVWYFGLHYVDNK
AKFYPEDVAEELIQDITQK
FYPEDVAEELIQDITQK
EGILSDEIYCPPETAVLLGSYAVQAK
DQWEDRIQVWHAEHR
IAQDLEMYGINYFEIK
GTDLWLGVDALGLNIYEK
IGFPWSEIR
IGFPWSEIRNISFNDK
KAPDFVFYAPR
APDFVFYAPR
ILQLCMGNHELYMR
ILQLCMGNHELYMRR
QAVDQIKSQEQLAAELAEYTAK
AKEAQDDLVK
QRIDEFEAL
P5 gi|22749235 74,604FLJ382812.5e−0024.1%24
QCGKAFESCSSSVR
QCGKAFESCSSSVR